McDonnell Genome Institute

Washington University

Transcript

lnc-RPS24-20:1

Chromosome

chr10

Gene Name

lnc-RPS24-20

Start

77423035

CPC Label

noncoding

End

77430347

Cancer

OV

Strand

+

Peptide

EGHLSPQVASLTLTMYLHR

Modified Peptide

n[145]EGHLSPQVASLTLTMYLHR

Peptide Length

19

ORF Length

46

Open Reading Frame (ORF)

MQLCSLSTQGLALGLGQGRHLGDCCKREGHLSPQVASLTLTMYLHR

Conservation Score

0.76

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.361073

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8998

PhyloCSF Frame 3

0

CNTI Score

-0.37779889