McDonnell Genome Institute

Washington University

Transcript

lnc-RPS21-4:1

Chromosome

chr20

Gene Name

lnc-RPS21-4

Start

62480598

CPC Label

noncoding

End

62491189

Cancer

OSCC

Strand

+

Peptide

SVTLEEGGAVHLR

Modified Peptide

n[145]SVTLEEGGAVHLR

Peptide Length

13

ORF Length

83

Open Reading Frame (ORF)

MCGTLGGHLGSSPALPLGLWDPGGATPCSVPRSVTLEEGGAVHLRGRWLHLKGKGPRPARCFEYSPGAASRGCSGGRPDPAGM

Conservation Score

0.389

PhyloCSF Frame 1

-4.165

No. of Spectra

8

CPC Coding Probability

0.235894

PhyloCSF Frame 2 

-3.892

CNTI Index

noncoding

Max Probability

0.9966

PhyloCSF Frame 3

-4.152

CNTI Score

-0.292778988