McDonnell Genome Institute

Washington University

Transcript

lnc-RPS20-5:1

Chromosome

chr8

Gene Name

lnc-RPS20-5

Start

56050062

CPC Label

coding

End

56051160

Cancer

BRCA-Luminal A

Strand

-

Peptide

TLTELLNQMDGFDTLHR

Modified Peptide

n[145]TLTELLNQM[147]DGFDTLHR

Peptide Length

17

ORF Length

335

Open Reading Frame (ORF)

LKALRSVGQIVGEVFKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLIYNMSHEDPENVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAIASQLDCNFLKVVSSSIVDKYIGESAHLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLTELLNQMDGFDTLHRVKMIMATNRPDTLDPALLCPGRLDRKIHIDLPNEQTRLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.5

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.809

PhyloCSF Frame 3

0

CNTI Score

0.737286223