McDonnell Genome Institute

Washington University

Transcript

lnc-RPS2-1:1

Chromosome

chr16

Gene Name

lnc-RPS2-1

Start

1954656

CPC Label

noncoding

End

1957597

Cancer

OV

Strand

-

Peptide

APTGYLGPHLAWPVLSWEGHDPAPGPSR

Modified Peptide

n[145]APTGYLGPHLAWPVLSWEGHDPAPGPSR

Peptide Length

28

ORF Length

51

Open Reading Frame (ORF)

LAAAWEKAPTGYLGPHLAWPVLSWEGHDPAPGPSRKGVPALAPGAPLRLSI

Conservation Score

0.37

PhyloCSF Frame 1

-3.751

No. of Spectra

2

CPC Coding Probability

0.026791

PhyloCSF Frame 2 

-3.595

CNTI Index

noncoding

Max Probability

0.6688

PhyloCSF Frame 3

-5.102

CNTI Score

-0.304420078