McDonnell Genome Institute

Washington University

Transcript

lnc-RPRML-3:13

Chromosome

chr17

Gene Name

lnc-RPRML-3

Start

47055084

CPC Label

noncoding

End

47100297

Cancer

OV

Strand

-

Peptide

VAGGPGCPGGGPGPRPGAR

Modified Peptide

n[145]VAGGPGCPGGGPGPRPGAR

Peptide Length

19

ORF Length

166

Open Reading Frame (ORF)

LVEPRRKVRGWGSSRWLWCPWGWEHEWARMMVRQRRRPRGSARLRGGGPRGPGSGRHRGPWKRQGWGRGDACVEHGDPSPAPTCRPGPRAAGRVAGGPGCPGGGPGPRPGARSGVRVARPSRGGTDRRREEGKPPGLKILSLRSHSEVHAAFMSCNTHREDLQLHS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.27599

PhyloCSF Frame 2 

0.756

CNTI Index

noncoding

Max Probability

0.5411

PhyloCSF Frame 3

0.249

CNTI Score

-0.292680702