McDonnell Genome Institute

Washington University

Transcript

lnc-RPRML-1:4

Chromosome

chr17

Gene Name

lnc-RPRML-1

Start

46914199

CPC Label

noncoding

End

46922846

Cancer

BRCA-Luminal B

Strand

-

Peptide

AVEVGLPK

Modified Peptide

n[145]AVEVGLPK

Peptide Length

8

ORF Length

81

Open Reading Frame (ORF)

MWDWSHHIVCSRAVPSEAAGMEPSPRPQNCSPTSMQLQPGNCRQETQSIRAAAWTEPRKAVEVGLPKALGNQPPSMSRSGT

Conservation Score

0.606

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.239066

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9968

PhyloCSF Frame 3

0

CNTI Score

-0.32064665