McDonnell Genome Institute

Washington University

Transcript

lnc-RPRM-9:1

Chromosome

chr2

Gene Name

lnc-RPRM-9

Start

154296744

CPC Label

noncoding

End

154298326

Cancer

LUAD

Strand

-

Peptide

NIQTEMFK

Modified Peptide

n[230]NIQTEM[147]FK

Peptide Length

8

ORF Length

111

Open Reading Frame (ORF)

MLAFISLYTFHGWSHLLLLIYIGPACQQSQIYISAQTSFLGSRLVYPYIYLIPPLVCPRNIQTEMFKLGLLIHPCSVSQVLFFSIFFFQLIVYGANIHPDSQTNKYTSKVK

Conservation Score

0.213

PhyloCSF Frame 1

-4.087

No. of Spectra

6

CPC Coding Probability

0.174988

PhyloCSF Frame 2 

-4.306

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

-5.139

CNTI Score

-0.435396919