McDonnell Genome Institute

Washington University

Transcript

lnc-RPRM-3:1

Chromosome

chr2

Gene Name

lnc-RPRM-3

Start

154435852

CPC Label

noncoding

End

154457438

Cancer

BRCA-Luminal B

Strand

-

Peptide

LPYFSWINVK

Modified Peptide

n[145]LPYFSWINVK

Peptide Length

10

ORF Length

73

Open Reading Frame (ORF)

MLPYFSWINVKSGLICFVYLGNNLVCMLVSRMSFTLHNNKKVSACQYIHILLDFIWKLLGLISIIYHLYPLAF

Conservation Score

0.085

PhyloCSF Frame 1

-3.742

No. of Spectra

9

CPC Coding Probability

0.114634

PhyloCSF Frame 2 

-4.755

CNTI Index

noncoding

Max Probability

0.9984

PhyloCSF Frame 3

-5.435

CNTI Score

-0.362729318