McDonnell Genome Institute

Washington University

Transcript

lnc-RPP40-4:2

Chromosome

chr6

Gene Name

lnc-RPP40-4

Start

4988503

CPC Label

noncoding

End

4992359

Cancer

LUAD

Strand

-

Peptide

IFSCSNK

Modified Peptide

n[230]IFSCSNK

Peptide Length

7

ORF Length

40

Open Reading Frame (ORF)

LRNNLRKIFSCSNKNHSTGFIIYVKVKWVKSFSQVHMEHL

Conservation Score

0.163

PhyloCSF Frame 1

0

No. of Spectra

13

CPC Coding Probability

0.150059

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

0

CNTI Score

-0.392511169