McDonnell Genome Institute

Washington University

Transcript

lnc-RPP40-1:8

Chromosome

chr6

Gene Name

lnc-RPP40-1

Start

5042306

CPC Label

noncoding

End

5054739

Cancer

EOGC

Strand

-

Peptide

LGCGLWIGWFVFEK

Modified Peptide

n[145]LGCGLWIGWFVFEK

Peptide Length

14

ORF Length

81

Open Reading Frame (ORF)

LGCGLWIGWFVFEKCAPGRRRTPEEWGVAQRRRQGRPEAEAKHTVGFSRSRNVWCMHVGQILKHRLYRRQKHGQYIGPVTL

Conservation Score

0.674

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0615182

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.352363015