McDonnell Genome Institute

Washington University

Transcript

lnc-RPP40-1:6

Chromosome

chr6

Gene Name

lnc-RPP40-1

Start

5042306

CPC Label

noncoding

End

5054739

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

RGIHSVGWGR

Modified Peptide

n[145]RGIHSVGWGR

Peptide Length

10

ORF Length

56

Open Reading Frame (ORF)

LTPPSHHGLMWFFRYFLESFLAKRGIHSVGWGRLEFYFCFALLVTKYDSQDSRGML

Conservation Score

0.265

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.059835

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9966

PhyloCSF Frame 3

0

CNTI Score

-0.352363015