McDonnell Genome Institute

Washington University

Transcript

lnc-RPP38-3:1

Chromosome

chr10

Gene Name

lnc-RPP38-3

Start

15237491

CPC Label

noncoding

End

15241767

Cancer

OSCC

Strand

+

Peptide

ALTDNMPADGPGK

Modified Peptide

n[145]ALTDNM[147]PADGPGK

Peptide Length

13

ORF Length

53

Open Reading Frame (ORF)

LVCGDISFCCNDSTLRCSAKALTDNMPADGPGKVPVKLYLGMLTYKFHVIFDP

Conservation Score

0.889

PhyloCSF Frame 1

-4.851

No. of Spectra

3

CPC Coding Probability

0.0412636

PhyloCSF Frame 2 

-5.26

CNTI Index

noncoding

Max Probability

0.8451

PhyloCSF Frame 3

-4.345

CNTI Score

-0.383755966