McDonnell Genome Institute

Washington University

Transcript

lnc-RPP30-7:1

Chromosome

chr10

Gene Name

lnc-RPP30-7

Start

90971857

CPC Label

noncoding

End

90980673

Cancer

OV

Strand

+

Peptide

LPHFSSPRLFYTHSK

Modified Peptide

n[145]LPHFSSPRLFYTHSK

Peptide Length

15

ORF Length

95

Open Reading Frame (ORF)

LPHFSSPRLFYTHSKFRLSEWHVHKRSTTVTGEWEMENQRNVSIAGKFHTEIRYLEKDSLKTDSLYPYILKRPHVPQEACVSQFEGQYSRRDKNV

Conservation Score

0.871

PhyloCSF Frame 1

-4.391

No. of Spectra

1

CPC Coding Probability

0.160556

PhyloCSF Frame 2 

-4.506

CNTI Index

noncoding

Max Probability

0.6228

PhyloCSF Frame 3

-4.837

CNTI Score

-0.402087551