McDonnell Genome Institute

Washington University

Transcript

lnc-RPP30-2:5

Chromosome

chr10

Gene Name

lnc-RPP30-2

Start

90947299

CPC Label

noncoding

End

90992132

Cancer

OV

Strand

+

Peptide

MAVSAMK

Modified Peptide

n[145]MAVSAMK

Peptide Length

7

ORF Length

101

Open Reading Frame (ORF)

MAVSAMKENKTRPECNGTTFPHCSLDLLGSSDSPTSASRVAGISDVHHHAQLPCEVSRADLDWHLYQQLSGIKWLANVTRWSFALVTQAEVAVSQDHPTAL

Conservation Score

1

PhyloCSF Frame 1

1.349

No. of Spectra

20

CPC Coding Probability

0.314639

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7325

PhyloCSF Frame 3

0

CNTI Score

-0.384727147