McDonnell Genome Institute

Washington University

Transcript

lnc-RPP25-5:1

Chromosome

chr15

Gene Name

lnc-RPP25-5

Start

75040666

CPC Label

noncoding

End

75043758

Cancer

OV

Strand

-

Peptide

AGQGGAMLK

Modified Peptide

n[145]AGQGGAMLK

Peptide Length

9

ORF Length

44

Open Reading Frame (ORF)

LHYPSPEPSPGDATGPAQVGRAGQGGAMLKALSLSWGRHKIVMR

Conservation Score

0.047

PhyloCSF Frame 1

-4.101

No. of Spectra

2

CPC Coding Probability

0.246944

PhyloCSF Frame 2 

-5.716

CNTI Index

noncoding

Max Probability

0.9307

PhyloCSF Frame 3

-2.865

CNTI Score

-0.307745975