McDonnell Genome Institute

Washington University

Transcript

lnc-RPN2-4:1

Chromosome

chr20

Gene Name

lnc-RPN2-4

Start

37049253

CPC Label

noncoding

End

37049707

Cancer

CCRC

Strand

+

Peptide

MSDYNIQKESTLHLVLR

Modified Peptide

n[230]MSDYNIQKESTLHLVLR

Peptide Length

17

ORF Length

106

Open Reading Frame (ORF)

LLASNWKMSDYNIQKESTLHLVLRLHGGAKKRKKSYTTPKKSKHKRKKVKLAILKYYKVDENGKISCFRRECPSDECGAGVFMASHFDRHYCGKCLTYCFNKPEDN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.374599

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9337

PhyloCSF Frame 3

0

CNTI Score

-0.341692429