McDonnell Genome Institute

Washington University

Transcript

lnc-RPLP1-12:53

Chromosome

chr15

Gene Name

lnc-RPLP1-12

Start

69835238

CPC Label

noncoding

End

69842030

Cancer

CCRC

Strand

+

Peptide

ANGLGMPPVVFPGK

Modified Peptide

ANGLGMPPVVFPGK

Peptide Length

14

ORF Length

57

Open Reading Frame (ORF)

LGGAGSLGVEVGRANGLGMPPVVFPGKACPDCRCLLYLQCQSWGPACIVGSRKSFSC

Conservation Score

0.305

PhyloCSF Frame 1

-4.096

No. of Spectra

27

CPC Coding Probability

0.272847

PhyloCSF Frame 2 

-3.49

CNTI Index

noncoding

Max Probability

0.9965

PhyloCSF Frame 3

-2.905

CNTI Score

-0.388281057