McDonnell Genome Institute

Washington University

Transcript

lnc-RPLP1-12:50

Chromosome

chr15

Gene Name

lnc-RPLP1-12

Start

69835233

CPC Label

noncoding

End

69842966

Cancer

LUAD

Strand

+

Peptide

GAPNLLK

Modified Peptide

GAPNLLK

Peptide Length

7

ORF Length

52

Open Reading Frame (ORF)

MLISSGLETPYLRGAPNLLKAFSCPLQLSCQAISLQGRRGNWNTDTHRGKTK

Conservation Score

1

PhyloCSF Frame 1

-4.809

No. of Spectra

295

CPC Coding Probability

0.0498708

PhyloCSF Frame 2 

-4.192

CNTI Index

noncoding

Max Probability

0.9989

PhyloCSF Frame 3

-5.02

CNTI Score

-0.330915799