McDonnell Genome Institute

Washington University

Transcript

lnc-RPLP1-12:5

Chromosome

chr15

Gene Name

lnc-RPLP1-12

Start

69462992

CPC Label

coding

End

69575439

Cancer

PRAD

Strand

+

Peptide

VELASDPR

Modified Peptide

‚Äč

Peptide Length

8

ORF Length

117

Open Reading Frame (ORF)

LLLYFYPNITSIKASKSREKHQLMPSCPPRLLLDSRDRKVEIIPHFIERETKVQRRVELASDPRLHPWQTGKGVSGGVATGIGPRKALLCHFERTGHHLGWPCQLEPALLLQRHPGQ

Conservation Score

0.88

PhyloCSF Frame 1

-2.593

No. of Spectra

1

CPC Coding Probability

0.506382

PhyloCSF Frame 2 

-2.851

CNTI Index

noncoding

Max Probability

0.9952

PhyloCSF Frame 3

-4.374

CNTI Score

-0.334938025