McDonnell Genome Institute

Washington University

Transcript

lnc-RPLP1-12:43

Chromosome

chr15

Gene Name

lnc-RPLP1-12

Start

69628783

CPC Label

coding

End

69840828

Cancer

OSCC

Strand

+

Peptide

STQKWQTGR

Modified Peptide

n[145]STQKWQTGR

Peptide Length

9

ORF Length

56

Open Reading Frame (ORF)

LRSTQKWQTGRDGTPTYSTCSPTLPSLLGEGCVACSDQRRHTLGICRFHSRPPPTK

Conservation Score

0.511

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.645484

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9733

PhyloCSF Frame 3

0

CNTI Score

-0.400012214