McDonnell Genome Institute

Washington University

Transcript

lnc-RPLP1-12:38

Chromosome

chr15

Gene Name

lnc-RPLP1-12

Start

69592128

CPC Label

noncoding

End

69612890

Cancer

OV

Strand

+

Peptide

GVWFEVSEHFK

Modified Peptide

n[145]GVWFEVSEHFK

Peptide Length

11

ORF Length

43

Open Reading Frame (ORF)

MGVWFEVSEHFKKLPLSFYLGFQEHQGNVLNFFVRFKVFPPLV

Conservation Score

0.106

PhyloCSF Frame 1

-4.572

No. of Spectra

75

CPC Coding Probability

0.0513306

PhyloCSF Frame 2 

-4.487

CNTI Index

noncoding

Max Probability

0.9978

PhyloCSF Frame 3

-5.843

CNTI Score

-0.302439576