McDonnell Genome Institute

Washington University

Transcript

lnc-RPLP1-12:25

Chromosome

chr15

Gene Name

lnc-RPLP1-12

Start

69561956

CPC Label

noncoding

End

69680396

Cancer

OV

Strand

+

Peptide

LGGQMPQLDSQR

Modified Peptide

n[145]LGGQMPQLDSQR

Peptide Length

12

ORF Length

60

Open Reading Frame (ORF)

LIWSMKCERSDIHFEAGTFRLELTFHMEWELTLRHFLDKSLDWREKLGGQMPQLDSQRIS

Conservation Score

0.321

PhyloCSF Frame 1

-6.51

No. of Spectra

3

CPC Coding Probability

0.335864

PhyloCSF Frame 2 

-4.351

CNTI Index

noncoding

Max Probability

0.935

PhyloCSF Frame 3

-5.923

CNTI Score

-0.3330603