McDonnell Genome Institute

Washington University

Transcript

lnc-RPL7L1-2:1

Chromosome

chr6

Gene Name

lnc-RPL7L1-2

Start

42892093

CPC Label

noncoding

End

42892898

Cancer

OV

Strand

+

Peptide

SVDCLNSGIQDQPGQYSK

Modified Peptide

n[145]SVDCLNSGIQDQPGQYSK

Peptide Length

18

ORF Length

33

Open Reading Frame (ORF)

LRSVDCLNSGIQDQPGQYSKTPSLLKNTKKKNC

Conservation Score

0.143

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.00620178

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9973

PhyloCSF Frame 3

0

CNTI Score

-0.388357899