McDonnell Genome Institute

Washington University

Transcript

lnc-RPL7A-2:1

Chromosome

chr9

Gene Name

lnc-RPL7A-2

Start

133338989

CPC Label

noncoding

End

133339465

Cancer

BRCA-Luminal A

Strand

+

Peptide

NVHIQHTK

Modified Peptide

n[145]NVHIQHTK

Peptide Length

8

ORF Length

59

Open Reading Frame (ORF)

MNVHIQHTKHSKSRESFLKRVKENDQKKREAKEKGTWIQLKRQPAPPRAAHCENQWEGA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0636453

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6327

PhyloCSF Frame 3

0

CNTI Score

-0.342052739