McDonnell Genome Institute

Washington University

Transcript

lnc-RPL7-4:1

Chromosome

chr8

Gene Name

lnc-RPL7-4

Start

73277363

CPC Label

noncoding

End

73278046

Cancer

GBM

Strand

-

Peptide

MMFMGFICLGVWYF

Modified Peptide

n[230]M[147]M[147]FMGFICLGVWYF

Peptide Length

14

ORF Length

77

Open Reading Frame (ORF)

LFPLLRGSCGSVLPKTHVDELGVPLYAVVKEHIRNEVKDFQPYFKRETFLDEKKKFYGPQRQKMMFMGFICLGVWYF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0564891

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6528

PhyloCSF Frame 3

0

CNTI Score

-0.334568888