McDonnell Genome Institute

Washington University

Transcript

lnc-RPL6-1:1

Chromosome

chr12

Gene Name

lnc-RPL6-1

Start

112722567

CPC Label

noncoding

End

112726377

Cancer

BRCA-Luminal B

Strand

-

Peptide

GQLYIHTNIIR

Modified Peptide

n[145]GQLYIHTNIIR

Peptide Length

11

ORF Length

65

Open Reading Frame (ORF)

LYRGRELSVPLIPTLLKGQLYIHTNIIRQDQRNEIDEQFRQIVKLLFFLCLPLFPTDPHSSSLSV

Conservation Score

0.266

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0455795

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.353225878