McDonnell Genome Institute

Washington University

Transcript

lnc-RPL5-2:1

Chromosome

chr1

Gene Name

lnc-RPL5-2

Start

92755793

CPC Label

noncoding

End

92756956

Cancer

OV

Strand

+

Peptide

LYLAAVSHLLLASK

Modified Peptide

n[145]LYLAAVSHLLLASK

Peptide Length

14

ORF Length

49

Open Reading Frame (ORF)

LYLAAVSHLLLASKSEEKEDSVPKLEQLNSLGVMTNMNVVLTKQNLLHV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.16822

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

0

CNTI Score

-0.368498513