McDonnell Genome Institute

Washington University

Transcript

lnc-RPL38-1:1

Chromosome

chr17

Gene Name

lnc-RPL38-1

Start

73912131

CPC Label

noncoding

End

73915809

Cancer

OV

Strand

+

Peptide

ISFDGLISTPK

Modified Peptide

n[145]ISFDGLISTPK

Peptide Length

11

ORF Length

37

Open Reading Frame (ORF)

LGIQETRKKTKSEKKISFDGLISTPKTAKYVNRNYTN

Conservation Score

0.189

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0893731

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9667

PhyloCSF Frame 3

-5.111

CNTI Score

-0.349583375