McDonnell Genome Institute

Washington University

Transcript

lnc-RPL37-1:6

Chromosome

chr5

Gene Name

lnc-RPL37-1

Start

40825262

CPC Label

noncoding

End

40829142

Cancer

LUAD

Strand

-

Peptide

FMLVIPALWEAQR

Modified Peptide

n[230]FMLVIPALWEAQR

Peptide Length

13

ORF Length

46

Open Reading Frame (ORF)

LYLMDPSQFKILCQVRRFMLVIPALWEAQRCHWLEPKSLRPAWATW

Conservation Score

0.139

PhyloCSF Frame 1

0

No. of Spectra

25

CPC Coding Probability

0.0909592

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

0

CNTI Score

-0.369740792