McDonnell Genome Institute

Washington University

Transcript

lnc-RPL36AL-4:1

Chromosome

chr14

Gene Name

lnc-RPL36AL-4

Start

49577391

CPC Label

noncoding

End

49577794

Cancer

BRCA-Basal-like

Strand

-

Peptide

LGTSQTDMSK

Modified Peptide

n[145]LGTSQTDMSK

Peptide Length

10

ORF Length

114

Open Reading Frame (ORF)

LGTSQTDMSKLRVTGGNTEVLTTGFIEGLRARSMPNIGYGRNKKTKHILPSGFWKFLVHNVKELEVLLVSNKSYCVEITHDVSSKNCKAILERAAQVVIRVTNANASLHSAESE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.322074

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5293

PhyloCSF Frame 3

0

CNTI Score

-0.317688794