McDonnell Genome Institute

Washington University

Transcript

lnc-RPL36AL-1:1

Chromosome

chr14

Gene Name

lnc-RPL36AL-1

Start

49620814

CPC Label

coding

End

49623480

Cancer

OV

Strand

-

Peptide

LGTLSGWSTGFLVMHTTVSSMK

Modified Peptide

n[145]LGTLSGWSTGFLVM[147]HTTVSSM[147]K

Peptide Length

22

ORF Length

73

Open Reading Frame (ORF)

LGTLSGWSTGFLVMHTTVSSMKDPRNLRNQHFPEFWKTRYSQVLKSPVPVIIIISTESVCALDQLLIGIPGQG

Conservation Score

1

PhyloCSF Frame 1

-4.475

No. of Spectra

1

CPC Coding Probability

0.671113

PhyloCSF Frame 2 

-2.101

CNTI Index

coding

Max Probability

0.8934

PhyloCSF Frame 3

13.756

CNTI Score

0.722610542