McDonnell Genome Institute

Washington University

Transcript

lnc-RPL31-1:1

Chromosome

chr2

Gene Name

lnc-RPL31-1

Start

100822660

CPC Label

noncoding

End

100847220

Cancer

OSCC

Strand

+

Peptide

LIPCTVQLFPK

Modified Peptide

n[145]LIPCTVQLFPK

Peptide Length

11

ORF Length

78

Open Reading Frame (ORF)

MLIPCTVQLFPKRDSNSGHLGEDPSCISHSYQMLHAGKVLGCTESSSACLLSIYHIESPDDKKMRRWVVPALEELTSL

Conservation Score

1

PhyloCSF Frame 1

-4.022

No. of Spectra

1

CPC Coding Probability

0.113037

PhyloCSF Frame 2 

-3.671

CNTI Index

noncoding

Max Probability

0.4878

PhyloCSF Frame 3

-3.768

CNTI Score

-0.384317956