McDonnell Genome Institute

Washington University

Transcript

lnc-RPL30-8:2

Chromosome

chr8

Gene Name

lnc-RPL30-8

Start

97771590

CPC Label

noncoding

End

97775726

Cancer

OV

Strand

-

Peptide

EFYILEILLFKI

Modified Peptide

n[145]EFYILEILLFKI

Peptide Length

12

ORF Length

49

Open Reading Frame (ORF)

MRLFQQLNSQQAPIVTFPFSLPTRISYLLGKSIIDSREFYILEILLFKI

Conservation Score

1

PhyloCSF Frame 1

-5.2

No. of Spectra

45

CPC Coding Probability

0.0311746

PhyloCSF Frame 2 

-1.456

CNTI Index

noncoding

Max Probability

0.955

PhyloCSF Frame 3

-4.722

CNTI Score

-0.35049004