McDonnell Genome Institute

Washington University

Transcript

lnc-RPL30-6:1

Chromosome

chr8

Gene Name

lnc-RPL30-6

Start

97858048

CPC Label

noncoding

End

97858947

Cancer

HCC

Strand

-

Peptide

MANEKPK

Modified Peptide

n[43]M[147]ANEKPK

Peptide Length

7

ORF Length

84

Open Reading Frame (ORF)

MANEKPKERVKTVVQFKRHTPLSKLKKERGIHLSKLTGAYCEGQGLSMRQIRLQFDSETDTLAQLEKEDEDTIDVLQQQTGGVY

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.0519484

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9837

PhyloCSF Frame 3

0

CNTI Score

-0.349244066