McDonnell Genome Institute

Washington University

Transcript

lnc-RPL30-1:1

Chromosome

chr8

Gene Name

lnc-RPL30-1

Start

97724886

CPC Label

noncoding

End

97730250

Cancer

PRAD

Strand

-

Peptide

LIWPMTTQIEYYVPSSFMASGTK

Modified Peptide

LIWPMTTQIEYYVPSSFM[147]ASGTK

Peptide Length

23

ORF Length

47

Open Reading Frame (ORF)

MLIWPMTTQIEYYVPSSFMASGTKQLFEIEVYVLCVTSKKCSWGWGR

Conservation Score

0.037

PhyloCSF Frame 1

-5.573

No. of Spectra

1

CPC Coding Probability

0.0294794

PhyloCSF Frame 2 

-4.385

CNTI Index

noncoding

Max Probability

0.3171

PhyloCSF Frame 3

-5.226

CNTI Score

-0.384021704