McDonnell Genome Institute

Washington University

Transcript

lnc-RPL19-6:4

Chromosome

chr17

Gene Name

lnc-RPL19-6

Start

39239972

CPC Label

coding

End

39250065

Cancer

OSCC

Strand

+

Peptide

LAELWPSQPIR

Modified Peptide

n[145]LAELWPSQPIR

Peptide Length

11

ORF Length

66

Open Reading Frame (ORF)

LDSLPLLTPASVLPMPPDFYQEISLDELSAVELMGKLAELWPSQPIRSITFSTRAPGASSFSSVTR

Conservation Score

1

PhyloCSF Frame 1

2.719

No. of Spectra

25

CPC Coding Probability

0.567587

PhyloCSF Frame 2 

-3.731

CNTI Index

coding

Max Probability

0.9864

PhyloCSF Frame 3

1.03

CNTI Score

0.647259945