McDonnell Genome Institute

Washington University

Transcript

lnc-RPL13-5:1

Chromosome

chr16

Gene Name

lnc-RPL13-5

Start

89516796

CPC Label

noncoding

End

89522217

Cancer

PRAD

Strand

+

Peptide

VPAALGAQAQMTTTLK

Modified Peptide

VPAALGAQAQM[147]TTTLK

Peptide Length

16

ORF Length

43

Open Reading Frame (ORF)

LEAHRRKVPAALGAQAQMTTTLKAWREEVHRAAQWKGRAGRLG

Conservation Score

0.017

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.124895

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9963

PhyloCSF Frame 3

0

CNTI Score

-0.308711035