McDonnell Genome Institute

Washington University

Transcript

lnc-RPL12-1:3

Chromosome

chr9

Gene Name

lnc-RPL12-1

Start

127409635

CPC Label

noncoding

End

127424280

Cancer

LUAD

Strand

-

Peptide

SMTGAGIFGSQIK

Modified Peptide

n[230]SMTGAGIFGSQIK

Peptide Length

13

ORF Length

60

Open Reading Frame (ORF)

MWVNDQAGIPAVIKHQGKTCLPKSMTGAGIFGSQIKRVSGRARWLTPVIPALWEAEAGGS

Conservation Score

0.277

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.151548

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9667

PhyloCSF Frame 3

0

CNTI Score

-0.309166418