McDonnell Genome Institute

Washington University

Transcript

lnc-RPL10A-1:5

Chromosome

chr6

Gene Name

lnc-RPL10A-1

Start

35543661

CPC Label

coding

End

35554542

Cancer

OV

Strand

+

Peptide

EGGQEGGGGLGSLEQGPR

Modified Peptide

n[145]EGGQEGGGGLGSLEQGPR

Peptide Length

18

ORF Length

88

Open Reading Frame (ORF)

LSAPGWHRLSISRTPSGGVSSRVREGGQEGGGGLGSLEQGPRTMFKSWGGGECEARGGGGDRDGDGGGGAGGEDLLVSPRLCAVIIWF

Conservation Score

0.742

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.633985

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6815

PhyloCSF Frame 3

0

CNTI Score

-0.344205996