McDonnell Genome Institute

Washington University

Transcript

lnc-RPL10A-1:3

Chromosome

chr6

Gene Name

lnc-RPL10A-1

Start

35542393

CPC Label

coding

End

35554542

Cancer

OV

Strand

+

Peptide

WQMHQFSLEAPK

Modified Peptide

n[145]WQMHQFSLEAPK

Peptide Length

12

ORF Length

71

Open Reading Frame (ORF)

LQSLMLNHFRSFTLCGKEWSPRRKWQMHQFSLEAPKVPQENQGFRIQNNCTLVGWQMGTSSVLFPSPVLKH

Conservation Score

0.116

PhyloCSF Frame 1

-3.928

No. of Spectra

4

CPC Coding Probability

0.630072

PhyloCSF Frame 2 

-3.524

CNTI Index

noncoding

Max Probability

0.9917

PhyloCSF Frame 3

-2.797

CNTI Score

-0.344205996