McDonnell Genome Institute

Washington University

Transcript

lnc-RPL10A-1:2

Chromosome

chr6

Gene Name

lnc-RPL10A-1

Start

35542393

CPC Label

coding

End

35554542

Cancer

OV

Strand

+

Peptide

DFIYLLIYLR

Modified Peptide

n[145]DFIYLLIYLR

Peptide Length

10

ORF Length

180

Open Reading Frame (ORF)

LVLLAEATVLGFSLFYLGLPYSMATAFQEGVFQVLRVEAADVLETNLESHTTSLLTPSIGQSVTQPVQIQGEGKQTPLLHGRSGKEIAAIFIPSHMACLHDSSIGRFCFVPWEQSRPRGVLAAAVDLLQLLQKDFIYLLIYLRWSFALVAQAGVQWRNLSSLQSLPSGFKQFSCLSLPSS

Conservation Score

0.661

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.629743

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8677

PhyloCSF Frame 3

0

CNTI Score

-0.344205996