McDonnell Genome Institute

Washington University

Transcript

lnc-RPIA-30:1

Chromosome

chr2

Gene Name

lnc-RPIA-30

Start

91775341

CPC Label

noncoding

End

91782127

Cancer

BRCA-Basal-like

Strand

+

Peptide

GLGAGQPARVLGSGK

Modified Peptide

n[145]GLGAGQPARVLGSGK

Peptide Length

15

ORF Length

50

Open Reading Frame (ORF)

MGSEDKQGGFGRAEMRPRASGRGHGLHKGLGAGQPARVLGSGKETQALCF

Conservation Score

0.409

PhyloCSF Frame 1

-2.495

No. of Spectra

32

CPC Coding Probability

0.492077

PhyloCSF Frame 2 

-3.958

CNTI Index

coding

Max Probability

0.9994

PhyloCSF Frame 3

-3.478

CNTI Score

0.707190375