McDonnell Genome Institute

Washington University

Transcript

lnc-RPIA-2:1

Chromosome

chr2

Gene Name

lnc-RPIA-2

Start

88627538

CPC Label

noncoding

End

88631819

Cancer

EOGC

Strand

+

Peptide

GAGEDLK

Modified Peptide

n[145]GAGEDLK

Peptide Length

7

ORF Length

63

Open Reading Frame (ORF)

LVRSSVPGIPFLQQIGHRGGWPRPTKRGAGEDLKIIGGSGCPSKVCANCLLIGWKRHLLRGGF

Conservation Score

1

PhyloCSF Frame 1

-2.428

No. of Spectra

5

CPC Coding Probability

0.0157825

PhyloCSF Frame 2 

1.574

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

-1.127

CNTI Score

-0.329419956