McDonnell Genome Institute

Washington University

Transcript

lnc-RPIA-19:1

Chromosome

chr2

Gene Name

lnc-RPIA-19

Start

90052580

CPC Label

noncoding

End

90053372

Cancer

CCRC

Strand

+

Peptide

FSGVPDRFSGSGSGSDFTLK

Modified Peptide

n[230]FSGVPDRFSGSGSGSDFTLK

Peptide Length

20

ORF Length

117

Open Reading Frame (ORF)

LGLLMLWVPGSSGDIVMTQTPPSLPVNPGEPASISCRSSQSLLHSNGYTYLHWYPQKPGQSPQLLIYRVSSRFSGVPDRFSGSGSGSDFTLKISWVEAEDVGVYYCMQATQFPNTVV

Conservation Score

1

PhyloCSF Frame 1

-0.505

No. of Spectra

1

CPC Coding Probability

0.0568342

PhyloCSF Frame 2 

-4.097

CNTI Index

noncoding

Max Probability

0.8712

PhyloCSF Frame 3

-4.365

CNTI Score

-0.435850397