McDonnell Genome Institute

Washington University

Transcript

lnc-RPIA-1:4

Chromosome

chr2

Gene Name

lnc-RPIA-1

Start

88765901

CPC Label

coding

End

88806602

Cancer

EOGC

Strand

+

Peptide

AASDEKDSVSNIATEIK

Modified Peptide

n[145]AASDEKDSVSNIATEIK

Peptide Length

17

ORF Length

107

Open Reading Frame (ORF)

MDSLTSAKLTLKEADPSSKVAIRRKDSPPPGKVSSQKQPAEKAASDEKDSVSNIATEIKEGPISGTVSSQKQPAEKAASDEKDSVSNIATEIKDGQQSGRHNFAKQI

Conservation Score

0.996

PhyloCSF Frame 1

-4.265

No. of Spectra

14

CPC Coding Probability

0.999536

PhyloCSF Frame 2 

-3.569

CNTI Index

coding

Max Probability

1

PhyloCSF Frame 3

-4.877

CNTI Score

0.708305486