McDonnell Genome Institute

Washington University

Transcript

lnc-RPGR-6:4

Chromosome

chrX

Gene Name

lnc-RPGR-6

Start

38852830

CPC Label

coding

End

38870811

Cancer

LUAD

Strand

-

Peptide

MQVTGGR

Modified Peptide

n[230]MQVTGGR

Peptide Length

7

ORF Length

46

Open Reading Frame (ORF)

MAAVSEKMQVTGGRKKRRHRTAGSLRCLFTFSLLPKPPPWLPCWQM

Conservation Score

1

PhyloCSF Frame 1

-4.747

No. of Spectra

12

CPC Coding Probability

0.824944

PhyloCSF Frame 2 

-4.601

CNTI Index

noncoding

Max Probability

0.9987

PhyloCSF Frame 3

-5.015

CNTI Score

-0.331503839