McDonnell Genome Institute

Washington University

Transcript

lnc-RPGR-5:1

Chromosome

chrX

Gene Name

lnc-RPGR-5

Start

39111046

CPC Label

noncoding

End

39184731

Cancer

OV

Strand

-

Peptide

LANWIKSQK

Modified Peptide

n[145]LANWIKSQK

Peptide Length

9

ORF Length

69

Open Reading Frame (ORF)

MAGSNSHITILTLNVNGLNAPIQRHRLANWIKSQKTANQECHIQQNCPSKIKGKQRHSQKTKAEGVHHH

Conservation Score

0.152

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.128704

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

0

CNTI Score

-0.44958681