McDonnell Genome Institute

Washington University

Transcript

lnc-RPF2-3:1

Chromosome

chr6

Gene Name

lnc-RPF2-3

Start

111132817

CPC Label

coding

End

111134955

Cancer

PRAD

Strand

+

Peptide

GPWVVTHPGK

Modified Peptide

‚Äč

Peptide Length

10

ORF Length

40

Open Reading Frame (ORF)

LDPFLCGQERQEKGCRTATSVSATNLISRGPWVVTHPGKE

Conservation Score

0.191

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.981693

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9977

PhyloCSF Frame 3

0

CNTI Score

0.574220434