McDonnell Genome Institute

Washington University

Transcript

lnc-RPEL1-2:1

Chromosome

chr10

Gene Name

lnc-RPEL1-2

Start

103175553

CPC Label

noncoding

End

103176094

Cancer

LUAD

Strand

+

Peptide

EDGGSSSASQPEEMQEQGACSNKGTAQER

Modified Peptide

n[230]EDGGSSSASQPEEMQEQGACSNKGTAQER

Peptide Length

29

ORF Length

86

Open Reading Frame (ORF)

LLFHKNWKEDGGSSSASQPEEMQEQGACSNKGTAQERKAAATPESQEPQAKGAEGNAASEEAPGYRDIHSLGAESGPIPGSAEQNE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.267977

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6705

PhyloCSF Frame 3

0

CNTI Score

-0.28971744