McDonnell Genome Institute

Washington University

Transcript

lnc-RPE65-3:1

Chromosome

chr1

Gene Name

lnc-RPE65-3

Start

68375326

CPC Label

noncoding

End

68375663

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

AMLNSPGQFAENETNEVNFR

Modified Peptide

n[145]AMLNSPGQFAENETNEVNFR

Peptide Length

20

ORF Length

95

Open Reading Frame (ORF)

MYVKLIPSDGHEFIVKREHALISGMIKAMLNSPGQFAENETNEVNFREIPSYVLSKVCMYFTYKVRYTNSSTEIPEFPITPEIALELLVAVNFLD

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

16

CPC Coding Probability

0.0581056

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9988

PhyloCSF Frame 3

0

CNTI Score

0.594215732